The list is not found here but planets are ordered from closest to farthest to the Sun as Mercury, Venus, Earth, Mars, Jupiter, Saturn, Uranus, and Neptune.
What are the closest planets to the Sun?The closest planets to the Sun are rocky planets, i.e., Mercury, Venus, Earth and Mars.
Conversely, the farthest planets to the Sun are gaseous planets, i.e., Jupiter, Saturn, Uranus, and Neptune.
In conclusion, the list is not found here but planets are ordered from closest to farthest to the Sun as Mercury, Venus, Earth, Mars, Jupiter, Saturn, Uranus, and Neptune.
Learn more about rocky planets here:
https://brainly.com/question/17428928
#SPJ1
(!100 POINTS!)Who let the dogs out?
Answer:
Who, who, who, who, who?
Explanation:
Thank you so much you just made my day I hope you have a good rest of your day:>
Answer:
Explanation:
The dog walker of course! Thank you for points!
fia dose 48 spins in the evening she does 6 times as many spins in the evening than the morning how many did she do in the morning
Answer: 8
Explanation: 48 divided by 6=8
Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1
1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt
Part 2
1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)
Part 3
Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms
Part 4
Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.
Part 5
Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.
The appropriate verbs for the given sentences are given below:
Part 1
waswas lyingwouldfeelsPart 2
were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould bePart 3
hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshavePart 4
1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.Part 5
itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheirWhat is a Verb?This refers to the part of speech that shows action in a given sentence.
Hence, the words have been correctly selected above from the four different parts of the question.
Read more about verbs here:
https://brainly.com/question/1718605
#SPJ1
Which statement about retirement planning is true?
A. Retirement planning involves accounting for all future expenses.
B. Retirement planning involves accounting for an income after you
retire.
C. Retirement planning only considers immediate investment risks.
D. Retirement planning assumes your income will go up once you
stop working.
SUBMIT
Answer:
B. Retirement planning involves accounting for an income after you retire.
Explanation:
I took the test on Ap ex and got it right, hope this helps :)
Answer:
B. Retirement planning involves accounting for an income after you
Explanation:
Geologic Processes CFA 11 of 1411 of 14 Items Question S Use the two data tables above to answer the following questions: Predict elevation in 8 milliion years. Present Day= 2037 m 1 mya= __?__, 2 mya= __?__ 3 mya= 1947 m 4 mya=__?__ 5 mya= __?__ 6 mya= 1857 m 7 mya= __?__ 8 mya= __?__ Describe which geologic processes that caused this change in elevation
Answer:
Explanation:
Based on the data in the tables, we can predict that the elevation in 8 million years will be approximately 1857 m. This prediction is based on the trend in the data, which shows that the elevation decreases by approximately 90 m every million years. Since the elevation at 3 million years ago was 1947 m, and the elevation decreases by 90 m every million years, we can predict that the elevation in 8 million years will be 1947 m - (90 m * 5 million years) = 1857 m.
The geologic processes that caused this change in elevation are likely to be a combination of erosion and tectonic activity. Erosion is the process by which rocks and sediments are worn away by wind, water, and other natural forces, which can cause the elevation of an area to decrease over time. Tectonic activity, on the other hand, refers to the movement of the Earth's crust, which can cause the elevation of an area to change as a result of uplift or subsidence. Together, these processes can cause the elevation of an area to change over millions of years.
Jane is editing a letter she plans to send to a a prospective employer. She feels that a few words can be copied and pasted at a different location in the letter. Which key board shortcuts can help Jane achieve her task ?
Of the 310 students who watched a soccer match at college, 20 more students walked to the field than rode bicycles. If all students either walked or rode bicycles to the field, how many students walked?
Answer:
20
Explanation:
Global warming causes changes in long-term weather patterns like _______________ and _______________ that makes farming more challenging.
A . clouds, sunshine
B . hurricanes, blizzards
C . wildfires, high winds
D . rainfall, drought
Answer:
C and D
Explanation:
làm thế nào để xác định mình đã thích 1 người
A plant grew 17 inches in one year. 1 inch is approximately equivalent to 2. 5 centimetres. Approximately how much did the plant grow in centimetres?
Answer: Approximately 43 inches
Explanation:
If the plant grew 17 inches and each inch is equivalent to 2.5 cm, you would have to multiply 17 and 2.5.
17x2.5=42.5
And 42.5 is approximately 43.
PLEASE HELP the answer it says is D while I think it is A
But also A is kinda off as well SO I DON'T KNOW
The choice that offers an accurate interpretation of the data in the chart is D) a slightly higher rate of atherosclerosis than.
What is the graph about?The graph shows that patients who follow a low-cholesterol diet but do not exercise daily experience roughly 30% fewer cases of atherosclerosis than patients who do not follow a low-cholesterol diet and do not exercise daily.
Therefore, the accurate interpretation of the data in the chart is that patients who follow a low-cholesterol diet but do not exercise daily have a slightly higher rate of atherosclerosis than patients who do not follow a low-cholesterol diet and do not exercise daily.
Find out more on graphic representation here: https://brainly.com/question/28350999
#SPJ1
Select the correct answer.
Graduate school is not required for engineering,
OA True
B.
False
Answer:
the answer is a.true
Answer:
true
Explanation:
I need help with this. I don't understand it!
Answer: D
Explanation:
sorry if it's wrong
How would you ue a light microcope to view a wet mount of protit, auming the microcope i plugged in and that the light ource i on?
A light microscope is an instrument commonly used in the laboratory which makes use of light rays for viewing and enlarging smaller objects/organisms.
Explain why we have seasons and why some areas of Earth experience greater extremes in seasons than other areas.
Answer:
Seasons on Earth are primarily caused by the tilt of the Earth's axis and its orbit around the Sun
Explanation:
Seasons on Earth are primarily caused by the tilt of the Earth's axis and its orbit around the Sun.
The event in which a heavy metal ball is is thrown from the neck as far as possible
Answer:
shot put
Explanation:
it is a sport in track
A 10 kg ball is traveling at the same speed as a 1 kg ball. Compared to the 10 kg ball, the 1 kg ball has A) the same momentum B) 1/100 the momentum C) ten times the momentum D) 1/10 the momentum
Answer:
I think it is D
Explanation:
Answer:
Answer B I think
Explanation:
All of the attendees at a symposium are either phys-
icists or biologists. If there are 123 physicists and
270 biologists, then how many additional physicists
must arrive at the symposium in order for the ratio
of physicists to total attendees to become 2 to 5?
Answer:
The number of additional physicist that must arrive are;
59 physicists
Explanation:
A ratio in mathematics is an indication of the number of times one quantity is larger than another quantity, that is the number of times a number of an item is found the number of another item
The given parameters of the attendees at the symposium are;
The number of physicists at the symposium, p = 123 physicists
The number of biologists at the symposium, b = 270 biologists
The total number of attendees at the symposium, T = 123 + 270 = 393 attendees
Let 'x' represent the expected number of physicist at the symposium
For the ratio of physicists to the total attendees to become 2:5, we have;
x/Tₓ = 2/5
Where;
Tₓ = The expected total number of attendees at the symposium = x + 273
∴ x = (2/5) × Tₓ = (2/5) × (x + 273)
x = (2/5) × (x + 273) = 2·x/5 + 2×273/5
x - 2·x/5 = 2×273/5
3·x/5 = 2×273/5
3·x = 546
x = 546/3 = 182
The expected number of physicist at the symposium, x = 182 physicist
The number of additional physicist that must arrive = x - p
∴ The number of additional physicist that must arrive = 182 - 123 = 59
The number of additional physicist that must arrive = 59 physicists
An electronics company is trying to decide how many new
computers it should produce for export to China. Which factor
would most likely cause the company to produce a large number
of computers?
A. Chinese workers have a low degree of computer education
B. New technology makes shipping to China cheaper than
ever before.
c. Chinese consumers believe that computer prices will
drop in the future.
D. The Chinese government has recently raised taxes on
all foreign products
Answer: C
Explanation:
They would want to sell computers when the demand is high currently in China, and once the computer prices are dropped, they would be losing profit if they sold it then compared to now.
Go on kahoot and type in 272 9043 and play and will mark brainliest type in your brainly name so i know :)
Answer:
ok???
Explanation:
Answer:
yeehaaw
Explanation:
how do you think khanyi's relationship with her mother has been affected by the role that khanyi has to play
It may be inferred that when the reality program first aired, Khanyi and Khanz's relationship was rocky to say the least. Khanyi had left Khanz to straddle between boarding school and her mother's residence in an attempt to recapture her status.
When the show first aired, it seemed that Khanz knew Khanyi as well as a fan would—through television and social media posts. But it didn't take long for their relationship to grow.
What is an inference?Inferences are processes in thinking that move from premises to logical conclusions; the word infer is etymologically related to "carry forward." Theoretically, inference is typically separated into deduction and induction.
A person is considered to have drawn an inference when they reach a conclusion by combining one or two logical facts.
Learn more about inference:
brainly.com/question/25280941
#SPJ1
PLEASE HELP ASAP!!!
Answer:
Explanation:
Im only in 9th grade aint
no 11 grader LOL R.I.P YOU
1. How long has Barbie been in production for?
2. What changes have been made to Barbie over the years?
3. Has Barbie developed from a gender-specific product to a gender neutral product?
4. Have new characters been introduced to appeal to either gender? Has this been successful?
5. How does Barbie influence the construction of gender for young children in the 2020’s?
A pick up truck that sold for 18,722 in 1966 sales for 32,270 in 2002. What is the percent increase?
Explanation:
To find percent increase, you would simply divide 18722 by 32270
\( \frac{32270}{18722} = 1.72 = 172\%\)
when you hear romantic music what comes into your mind?which of the following words can best describe a romantic music?
PASSIONATE
ART
LITERATURE
LOVE SONG
PLAY
FREEDOM OF EXPRESSION
STRESSED EMOTION
BIRTHDAY SON
FEELINGS
SHOWING NATIONALISM
EMOTIONAL EXPRESSION
IMAGINATION
plss answer it rigth:(
"MUSIC"
Answer: In my opinion it would be (Passionate) because when i hear my romantic/villain playlist,i always feel passionate.
Explanation:
Answer:
passionate,love song,literature,feelings
Explanation:
2x + 3y = 6
-4x + 3y = 12
Answer:
\(x = -1, y = \frac{8}{3}\)
Explanation:
1. Isolate for x in 2x + 3y = 6:
x = \(\frac{6-3y}{2}\)
2. Plug x into the second equation:
-4( \(\frac{6-3y}{2}\)) + 3y = 12
3. Solve for y:
9y - 12 = 12
9y = 24
y = \(\frac{8}{3}\)
4. Plug y into the first equation:
2x +3( \(\frac{8}{3}\)) = 6
5. Solve for x:
2x + 8 = 6
2x = -2
x = -1
what is a three column cash book
Answer:
Blank 3 Column Cash Book Get Your Copy Today! Large Size 8.5 inches by 11 inches Include Sections for: Debit and Credit side Date Particulars Reference Discount Cash and Bank Buy one Today and have a safe record of your accounts
Explanation:
Find the probability of getting 6 or more girls in 8 births.
Answer:
The probability of getting a girl is 12 . The probability of getting 6 girls is therefore (12)6 . Since we have 6 girls, we also need to find the probability of getting 2 boys, which is (12)2 . There are (86)=28 ways to get 6 girls out of 8 children.
Explanation:
Answer:
Explanation:
P(X > 6) = ?
P(X > 6) = P(X = 6) + P(X = 7) + P(X = 8)
P(X > 6) = 0.118 + 0.035 + 0.004
P(X > 6) = 0.157
Thus the probability of getting 6 or more girls in 8 births is 0.157
Is anlyzing and interpreting information a record?
yes,
Explanation:
You are interpreting the said record whether no or yes,it is correct .You are analyzing the already written information ,not to get wrong
plz help asap i will mark you as brainlist